GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

sFRP-2   Click here for help

GtoPdb Ligand ID: 3692

Synonyms: SARP-1 | secreted apoptosis-related protein 1
Comment: Secreted frizzled-related protein 2 (sFRP2) is an endogenous Wnt signaling modulator.
Species: Human
Peptide Sequence Click here for help
LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCL
DDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDND
IMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQ
GGELVITSVKRWQKGQREFKRISRSIRKLQC
Post-translational Modification
Phosphorylation of the serine residue at position 265; disulfide bonds between cysteine residues at positions 16 and 79; 26 and 72; 63 and 101; 90and 128; 94 and 118; 148 and 221; 151 and 223; 166 and 271