GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BmTx1   Click here for help

GtoPdb Ligand ID: 14026

Compound class: Peptide
Comment: BmTx1 is a 37 amino acid toxin from the venom of the Chinese scorpion Buthus martensi [1]. It is a potassium channel blocker. We provide the amino acid sequence for the mature peptide without its signal peptide sequence.
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
QFTDVKCTGSKQCWPVCKQMFGKPNGKCMNGKCRCYS
Gln-Phe-Thr-Asp-Val-Lys-Cys-Thr-Gly-Ser-Lys-Gln-Cys-Trp-Pro-Val-Cys-Lys-Gln-Met-Phe-Gly-Lys-Pro-Asn-Gly-Lys-Cys-Met-Asn-Gly-Lys-Cys-Arg-Cys-Tyr-Ser